Eng: Proteins are made up of
strings of amino acids that fold into functional units. The three
dimensional structure was first solved for myoglobin in the late
1950’s. Since then tens of thousands of protein structures
have been elucidated. The coordinates for the cache can be found in
the amino acid sequence and the three dimensional structure of
myoglobin below.
Suom: Proteiinit koostuvat
aminohappoketjuista jotka muodostavat toiminnallisia yksiköitä.
Myoglobiinin kolmiulotteinen rakenne karakterisoitiin 1950-luvun
lopulla. Tämän jälkeen kymmenien tuhansien poteiinien rakenteet on
selvitetty. Kätkön koordinaatit löytyvät alla olevista myoglobiinin
rakenteesta ja aminohapposekvenssistä.
N:
E:
>gi|4885477|ref|NP_005359.1| myoglobin [Homo sapiens]
MGLSDGEWQBDLNVWGKVEADIPEDGQEVLIRLFKGHPETLEKFDDBHHLKSEDEMKASEDLKKHGATVLTALGGIL
KKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG